SCOP 1.59: Domain d1gule1: 1gul E:81-220

Lineage for d1gule1 (1gul E:81-220)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)

8. Domain d1gule1: 1gul E:81-220 [17679]
   Other proteins in same PDB: d1gula2, d1gulb2, d1gulc2, d1guld2, d1gule2, d1gulf2, d1gulg2, d1gulh2

Details for d1gule1

PDB Entry: 1gul, 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

SCOP Domain Sequences for d1gule1:

Sequence; same for both SEQRES and ATOM records:

>d1gule1 a.45.1.1 (E:81-220) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

Timeline for d1gule1:

• d1gule1 first appeared (with stable ids) in SCOP 1.55
  
• d1gule1 appears in SCOP 1.57
  
• d1gule1 appears in SCOP 1.61
  
• d1gule1 appears in the current release, SCOPe 2.08