SCOPe 2.05: Domain d1guld1: 1gul D:81-220

Lineage for d1guld1 (1gul D:81-220)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
   Uniprot P08263

8. Domain d1guld1: 1gul D:81-220 [17678]
   Other proteins in same PDB: d1gula2, d1gulb2, d1gulc2, d1guld2, d1gule2, d1gulf2, d1gulg2, d1gulh2

Details for d1guld1

PDB Entry: 1gul, 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

PDB Compounds: (D:) glutathione transferase a4-4

SCOPe Domain Sequences for d1guld1:

Sequence; same for both SEQRES and ATOM records:

>d1guld1 a.45.1.1 (D:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

Timeline for d1guld1:

• d1guld1 first appeared (with stable ids) in SCOP 1.55
  
• d1guld1 appears in SCOPe 2.04
  
• d1guld1 appears in SCOPe 2.06
  
• d1guld1 appears in the current release, SCOPe 2.08