Lineage for d1gulc1 (1gul C:81-220)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 213865Protein Class alpha GST [81349] (6 species)
  7. 213870Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (10 PDB entries)
  8. 213887Domain d1gulc1: 1gul C:81-220 [17677]
    Other proteins in same PDB: d1gula2, d1gulb2, d1gulc2, d1guld2, d1gule2, d1gulf2, d1gulg2, d1gulh2

Details for d1gulc1

PDB Entry: 1gul (more details), 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

SCOP Domain Sequences for d1gulc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gulc1 a.45.1.1 (C:81-220) Class alpha GST {Human (Homo sapiens), (a1-1)}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

SCOP Domain Coordinates for d1gulc1:

Click to download the PDB-style file with coordinates for d1gulc1.
(The format of our PDB-style files is described here.)

Timeline for d1gulc1: