SCOPe 2.06: Domain d3gmwc_: 3gmw C:

Lineage for d3gmwc_ (3gmw C:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia sp. [TaxId:299586] [188841] (1 PDB entry)

8. Domain d3gmwc_: 3gmw C: [176760]
   Other proteins in same PDB: d3gmwb_, d3gmwd_
   automated match to d1jtda_
   complexed with po4

Details for d3gmwc_

PDB Entry: 3gmw, 2.1 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-i (blip-i) in complex with tem-1 beta-lactamase

PDB Compounds: (C:) B-lactamase

SCOPe Domain Sequences for d3gmwc_:

Sequence; same for both SEQRES and ATOM records:

>d3gmwc_ e.3.1.1 (C:) automated matches {Escherichia sp. [TaxId: 299586]}
etlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvdag
qeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpke
ltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqql
idwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsq
atmdernrqiaeigaslikhw

Timeline for d3gmwc_:

• d3gmwc_ first appeared in SCOPe 2.01
  
• d3gmwc_ appears in SCOPe 2.05
  
• d3gmwc_ appears in SCOPe 2.07
  
• d3gmwc_ appears in the current release, SCOPe 2.08