Lineage for d3gmdf_ (3gmd F:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1151074Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1151163Species Mouse (Mus musculus) [TaxId:10090] [141879] (3 PDB entries)
    Uniprot P50172 24-298
  8. 1151171Domain d3gmdf_: 3gmd F: [176746]
    automated match to d1y5ma1
    complexed with 2m3, ndp, so4

Details for d3gmdf_

PDB Entry: 3gmd (more details), 2.28 Å

PDB Description: structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i
PDB Compounds: (F:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d3gmdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmdf_ c.2.1.2 (F:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
efrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaas
ahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnfl
syvvmstaalpmlkqsngsiavisslagkvtypmvapysaskfaldgffstirtelyitk
vnvsitlcvlglidtetamkavsgivnaqaspkeecaleiikgtalrksevyydkspltp
illgnpgrkimeffslryynkdmf

SCOPe Domain Coordinates for d3gmdf_:

Click to download the PDB-style file with coordinates for d3gmdf_.
(The format of our PDB-style files is described here.)

Timeline for d3gmdf_: