Lineage for d1gsfb1 (1gsf B:81-222)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538442Protein Class alpha GST [81349] (8 species)
  7. 538452Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (15 PDB entries)
  8. 538476Domain d1gsfb1: 1gsf B:81-222 [17674]
    Other proteins in same PDB: d1gsfa2, d1gsfb2
    complexed with eaa

Details for d1gsfb1

PDB Entry: 1gsf (more details), 2.7 Å

PDB Description: glutathione transferase a1-1 complexed with ethacrynic acid

SCOP Domain Sequences for d1gsfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsfb1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOP Domain Coordinates for d1gsfb1:

Click to download the PDB-style file with coordinates for d1gsfb1.
(The format of our PDB-style files is described here.)

Timeline for d1gsfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsfb2