SCOPe 2.08: Domain d3gjod_: 3gjo D:

Lineage for d3gjod_ (3gjo D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d3gjod_: 3gjo D: [176712]
   automated match to d1yiga1

Details for d3gjod_

PDB Entry: 3gjo, 2.5 Å

PDB Description: Crystal structure of human EB1 in complex with microtubule Tip localization signal peptide of MACF

PDB Compounds: (D:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d3gjod_:

Sequence, based on SEQRES records:

>d3gjod_ a.245.1.1 (D:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat

Sequence, based on observed residues (ATOM records):

>d3gjod_ a.245.1.1 (D:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqendpvlqrivdilyat

Timeline for d3gjod_:

• d3gjod_ first appeared in SCOPe 2.01
  
• d3gjod_ appears in SCOPe 2.07