Lineage for d1guha1 (1guh A:81-222)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443407Protein Class alpha GST [81349] (8 species)
  7. 443417Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (15 PDB entries)
  8. 443438Domain d1guha1: 1guh A:81-222 [17671]
    Other proteins in same PDB: d1guha2, d1guhb2

Details for d1guha1

PDB Entry: 1guh (more details), 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes

SCOP Domain Sequences for d1guha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guha1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOP Domain Coordinates for d1guha1:

Click to download the PDB-style file with coordinates for d1guha1.
(The format of our PDB-style files is described here.)

Timeline for d1guha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guha2