Lineage for d1gsea1 (1gse A:81-222)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153096Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)
  8. 153097Domain d1gsea1: 1gse A:81-222 [17667]
    Other proteins in same PDB: d1gsea2, d1gseb2

Details for d1gsea1

PDB Entry: 1gse (more details), 2 Å

PDB Description: glutathione transferase a1-1 complexed with an ethacrynic acid glutathione conjugate (mutant r15k)

SCOP Domain Sequences for d1gsea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsea1 a.45.1.1 (A:81-222) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOP Domain Coordinates for d1gsea1:

Click to download the PDB-style file with coordinates for d1gsea1.
(The format of our PDB-style files is described here.)

Timeline for d1gsea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsea2