Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries) |
Domain d1c72d1: 1c72 D:85-217 [17666] Other proteins in same PDB: d1c72a2, d1c72b2, d1c72c2, d1c72d2 complexed with epy |
PDB Entry: 1c72 (more details), 2.8 Å
SCOPe Domain Sequences for d1c72d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c72d1 a.45.1.1 (D:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpaylellpgklrqlsrflgsr swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk apifwytalwnnk
Timeline for d1c72d1: