SCOPe 2.05: Domain d1c72d1: 1c72 D:85-217

Lineage for d1c72d1 (1c72 D:85-217)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries)

8. Domain d1c72d1: 1c72 D:85-217 [17666]
   Other proteins in same PDB: d1c72a2, d1c72b2, d1c72c2, d1c72d2
   complexed with epy

Details for d1c72d1

PDB Entry: 1c72, 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1

PDB Compounds: (D:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1c72d1:

Sequence; same for both SEQRES and ATOM records:

>d1c72d1 a.45.1.1 (D:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpaylellpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

Timeline for d1c72d1:

• d1c72d1 first appeared (with stable ids) in SCOP 1.55
  
• d1c72d1 appears in SCOPe 2.04
  
• d1c72d1 appears in SCOPe 2.06
  
• d1c72d1 appears in the current release, SCOPe 2.08