![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
![]() | Protein Class mu GST [81348] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries) |
![]() | Domain d1c72d1: 1c72 D:85-217 [17666] Other proteins in same PDB: d1c72a2, d1c72b2, d1c72c2, d1c72d2 complexed with epy |
PDB Entry: 1c72 (more details), 2.8 Å
SCOP Domain Sequences for d1c72d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c72d1 a.45.1.1 (D:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpaylellpgklrqlsrflgsr swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk apifwytalwnnk
Timeline for d1c72d1: