Lineage for d3ghql_ (3ghq L:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 910833Protein Bacterioferritin (cytochrome b1) [47244] (5 species)
    binds heme between two subunits; 24-mer
  7. 910885Species Escherichia coli K-12 [TaxId:83333] [188868] (3 PDB entries)
  8. 910898Domain d3ghql_: 3ghq L: [176649]
    automated match to d1bcfa_
    complexed with fe, hem, so4; mutant

Details for d3ghql_

PDB Entry: 3ghq (more details), 2.7 Å

PDB Description: crystal structure of e. coli w35f bfr mutant
PDB Compounds: (L:) bacterioferritin

SCOPe Domain Sequences for d3ghql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ghql_ a.25.1.1 (L:) Bacterioferritin (cytochrome b1) {Escherichia coli K-12 [TaxId: 83333]}
mkgdtkvinylnkllgnelvainqyflharmfknfglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3ghql_:

Click to download the PDB-style file with coordinates for d3ghql_.
(The format of our PDB-style files is described here.)

Timeline for d3ghql_: