SCOPe 2.08: Domain d3gh3a_: 3gh3 A:

Lineage for d3gh3a_ (3gh3 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.0: automated matches [191355] (1 protein)
   not a true family

6. Protein automated matches [190390] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [189273] (2 PDB entries)

8. Domain d3gh3a_: 3gh3 A: [176633]
   automated match to d2ef1a1
   complexed with cac, so4

Details for d3gh3a_

PDB Entry: 3gh3, 1.8 Å

PDB Description: structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.

PDB Compounds: (A:) Ecto-NAD+ glycohydrolase (CD38 molecule)

SCOPe Domain Sequences for d3gh3a_:

Sequence; same for both SEQRES and ATOM records:

>d3gh3a_ c.23.14.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ysglnrwhgagstadfqkiiqercdtytqtirpgsrsrncqairqafmsafiskdpckat
kedynslinlapptvpcgqqvfwsktkelaheyakrrrlmtledtllgyladglrwcgep
gssdlniwscpdwrkdcrtnylsvfwevlserfaesacntvrvvlngslenafdsmsifg
rveapnlrpqveleawlvhdtgkppsdscsgssirklksildgrnvkfrcmdnlsrdqfl
q

Timeline for d3gh3a_:

• d3gh3a_ first appeared in SCOPe 2.01
  
• d3gh3a_ appears in SCOPe 2.07