Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
Family c.23.14.0: automated matches [191355] (1 protein) not a true family |
Protein automated matches [190390] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [189273] (2 PDB entries) |
Domain d3gh3a_: 3gh3 A: [176633] automated match to d2ef1a1 complexed with cac, so4 |
PDB Entry: 3gh3 (more details), 1.8 Å
SCOPe Domain Sequences for d3gh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gh3a_ c.23.14.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ysglnrwhgagstadfqkiiqercdtytqtirpgsrsrncqairqafmsafiskdpckat kedynslinlapptvpcgqqvfwsktkelaheyakrrrlmtledtllgyladglrwcgep gssdlniwscpdwrkdcrtnylsvfwevlserfaesacntvrvvlngslenafdsmsifg rveapnlrpqveleawlvhdtgkppsdscsgssirklksildgrnvkfrcmdnlsrdqfl q
Timeline for d3gh3a_: