Lineage for d1gsub1 (1gsu B:85-217)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153081Species Chicken (Gallus gallus), class mu [47624] (2 PDB entries)
  8. 153083Domain d1gsub1: 1gsu B:85-217 [17662]
    Other proteins in same PDB: d1gsua2, d1gsub2

Details for d1gsub1

PDB Entry: 1gsu (more details), 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution

SCOP Domain Sequences for d1gsub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsub1 a.45.1.1 (B:85-217) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpayleqlpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOP Domain Coordinates for d1gsub1:

Click to download the PDB-style file with coordinates for d1gsub1.
(The format of our PDB-style files is described here.)

Timeline for d1gsub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsub2