SCOPe 2.02: Domain d3gg7a_: 3gg7 A:

Lineage for d3gg7a_ (3gg7 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (11 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [188838] (1 PDB entry)

8. Domain d3gg7a_: 3gg7 A: [176612]
   automated match to d1zzma1
   complexed with mn, mpd, mrd, so4

Details for d3gg7a_

PDB Entry: 3gg7, 1.5 Å

PDB Description: crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans

PDB Compounds: (A:) uncharacterized metalloprotein

SCOPe Domain Sequences for d3gg7a_:

Sequence; same for both SEQRES and ATOM records:

>d3gg7a_ c.1.9.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
slidfhvhldlypdpvavaraceerqltvlsvtttpaawrgtlalaagrphvwtalgfhp
evvseraadlpwfdrylpetrfvgevgldgspslrgtwtqqfavfqhilrrcedhggril
sihsrraesevlncleanprsgtpilhwysgsvtelrraislgcwfsvgptmvrtqkgaa
lirsmprdrvltetdgpfleldgqaalpwdvksvveglskiwqipaseverivkenvsrl
lgt

Timeline for d3gg7a_:

• d3gg7a_ first appeared in SCOPe 2.01
  
• d3gg7a_ appears in SCOPe 2.03
  
• d3gg7a_ appears in the current release, SCOPe 2.08, called d3gg7a1