Lineage for d3gg7a_ (3gg7 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 972129Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 972130Protein automated matches [190150] (10 species)
    not a true protein
  7. 972134Species Deinococcus radiodurans [TaxId:1299] [188838] (1 PDB entry)
  8. 972135Domain d3gg7a_: 3gg7 A: [176612]
    automated match to d1zzma1
    complexed with mn, mpd, mrd, so4

Details for d3gg7a_

PDB Entry: 3gg7 (more details), 1.5 Å

PDB Description: crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans
PDB Compounds: (A:) uncharacterized metalloprotein

SCOPe Domain Sequences for d3gg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg7a_ c.1.9.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
slidfhvhldlypdpvavaraceerqltvlsvtttpaawrgtlalaagrphvwtalgfhp
evvseraadlpwfdrylpetrfvgevgldgspslrgtwtqqfavfqhilrrcedhggril
sihsrraesevlncleanprsgtpilhwysgsvtelrraislgcwfsvgptmvrtqkgaa
lirsmprdrvltetdgpfleldgqaalpwdvksvveglskiwqipaseverivkenvsrl
lgt

SCOPe Domain Coordinates for d3gg7a_:

Click to download the PDB-style file with coordinates for d3gg7a_.
(The format of our PDB-style files is described here.)

Timeline for d3gg7a_: