Lineage for d3gg7a1 (3gg7 A:2-242)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2834067Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2834068Protein automated matches [190150] (36 species)
    not a true protein
  7. 2834124Species Deinococcus radiodurans [TaxId:1299] [188838] (1 PDB entry)
  8. 2834125Domain d3gg7a1: 3gg7 A:2-242 [176612]
    Other proteins in same PDB: d3gg7a2
    automated match to d1zzma1
    complexed with mn, mpd, mrd, so4

Details for d3gg7a1

PDB Entry: 3gg7 (more details), 1.5 Å

PDB Description: crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans
PDB Compounds: (A:) uncharacterized metalloprotein

SCOPe Domain Sequences for d3gg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg7a1 c.1.9.0 (A:2-242) automated matches {Deinococcus radiodurans [TaxId: 1299]}
idfhvhldlypdpvavaraceerqltvlsvtttpaawrgtlalaagrphvwtalgfhpev
vseraadlpwfdrylpetrfvgevgldgspslrgtwtqqfavfqhilrrcedhggrilsi
hsrraesevlncleanprsgtpilhwysgsvtelrraislgcwfsvgptmvrtqkgaali
rsmprdrvltetdgpfleldgqaalpwdvksvveglskiwqipaseverivkenvsrllg
t

SCOPe Domain Coordinates for d3gg7a1:

Click to download the PDB-style file with coordinates for d3gg7a1.
(The format of our PDB-style files is described here.)

Timeline for d3gg7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gg7a2