Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (36 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [188838] (1 PDB entry) |
Domain d3gg7a1: 3gg7 A:2-242 [176612] Other proteins in same PDB: d3gg7a2 automated match to d1zzma1 complexed with mn, mpd, mrd, so4 |
PDB Entry: 3gg7 (more details), 1.5 Å
SCOPe Domain Sequences for d3gg7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gg7a1 c.1.9.0 (A:2-242) automated matches {Deinococcus radiodurans [TaxId: 1299]} idfhvhldlypdpvavaraceerqltvlsvtttpaawrgtlalaagrphvwtalgfhpev vseraadlpwfdrylpetrfvgevgldgspslrgtwtqqfavfqhilrrcedhggrilsi hsrraesevlncleanprsgtpilhwysgsvtelrraislgcwfsvgptmvrtqkgaali rsmprdrvltetdgpfleldgqaalpwdvksvveglskiwqipaseverivkenvsrllg t
Timeline for d3gg7a1: