![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (5 proteins) |
![]() | Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries) |
![]() | Domain d3gg3b_: 3gg3 B: [176611] automated match to d1jm4b_ complexed with cl |
PDB Entry: 3gg3 (more details), 2.25 Å
SCOPe Domain Sequences for d3gg3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gg3b_ a.29.2.1 (B:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs kklfmadlqrvftnckeynppeseyykcanilekfffskikeag
Timeline for d3gg3b_: