![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
![]() | Protein Class mu GST [81348] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries) |
![]() | Domain d1gsua1: 1gsu A:85-217 [17661] Other proteins in same PDB: d1gsua2, d1gsub2 |
PDB Entry: 1gsu (more details), 1.94 Å
SCOP Domain Sequences for d1gsua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpayleqlpgklrqlsrflgsr swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk apifwytalwnnk
Timeline for d1gsua1: