Lineage for d1gsua1 (1gsu A:85-217)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 97964Species Chicken (Gallus gallus), class mu [47624] (2 PDB entries)
  8. 97965Domain d1gsua1: 1gsu A:85-217 [17661]
    Other proteins in same PDB: d1gsua2, d1gsub2

Details for d1gsua1

PDB Entry: 1gsu (more details), 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution

SCOP Domain Sequences for d1gsua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsua1 a.45.1.1 (A:85-217) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpayleqlpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOP Domain Coordinates for d1gsua1:

Click to download the PDB-style file with coordinates for d1gsua1.
(The format of our PDB-style files is described here.)

Timeline for d1gsua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsua2