Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries) |
Domain d3gftd_: 3gft D: [176607] Other proteins in same PDB: d3gftb2, d3gftc2, d3gfte2, d3gftf2 automated match to d1aa9a_ complexed with cit, gnp, mg, unx |
PDB Entry: 3gft (more details), 2.27 Å
SCOPe Domain Sequences for d3gftd_:
Sequence, based on SEQRES records: (download)
>d3gftd_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
>d3gftd_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagmrtgeg flcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsy gipfietsaktrqgvddafytlvreirkhk
Timeline for d3gftd_: