Lineage for d1gscd1 (1gsc D:85-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713057Protein Class mu GST [81348] (3 species)
  7. 2713121Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 2713155Domain d1gscd1: 1gsc D:85-217 [17660]
    Other proteins in same PDB: d1gsca2, d1gscb2, d1gscc2, d1gscd2
    CA-atoms only

Details for d1gscd1

PDB Entry: 1gsc (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d1gscd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gscd1 a.45.1.1 (D:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOPe Domain Coordinates for d1gscd1:

Click to download the PDB-style file with coordinates for d1gscd1.
(The format of our PDB-style files is described here.)

Timeline for d1gscd1: