Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
Protein automated matches [190780] (4 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [188808] (2 PDB entries) |
Domain d3gfka_: 3gfk A: [176586] Other proteins in same PDB: d3gfkb1, d3gfkb2 automated match to d1z3ea1 protein/DNA complex; protein/RNA complex |
PDB Entry: 3gfk (more details), 2.3 Å
SCOPe Domain Sequences for d3gfka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gfka_ c.47.1.12 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkv
Timeline for d3gfka_: