Lineage for d3gfka_ (3gfk A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169507Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 1169520Protein automated matches [190780] (3 species)
    not a true protein
  7. 1169521Species Bacillus subtilis [TaxId:1423] [188808] (2 PDB entries)
  8. 1169523Domain d3gfka_: 3gfk A: [176586]
    Other proteins in same PDB: d3gfkb_
    automated match to d1z3ea1
    protein/DNA complex; protein/RNA complex

Details for d3gfka_

PDB Entry: 3gfk (more details), 2.3 Å

PDB Description: Crystal structure of Bacillus subtilis Spx/RNA polymerase alpha subunit C-terminal domain complex
PDB Compounds: (A:) Regulatory protein spx

SCOPe Domain Sequences for d3gfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gfka_ c.47.1.12 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkv

SCOPe Domain Coordinates for d3gfka_:

Click to download the PDB-style file with coordinates for d3gfka_.
(The format of our PDB-style files is described here.)

Timeline for d3gfka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gfkb_