SCOPe 2.01: Domain d3gfka_: 3gfk A:

Lineage for d3gfka_ (3gfk A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.12: ArsC-like [69518] (4 proteins)
   Pfam PF03960

6. Protein automated matches [190780] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188808] (2 PDB entries)

8. Domain d3gfka_: 3gfk A: [176586]
   Other proteins in same PDB: d3gfkb_
   automated match to d1z3ea1
   protein/DNA complex; protein/RNA complex

Details for d3gfka_

PDB Entry: 3gfk, 2.3 Å

PDB Description: Crystal structure of Bacillus subtilis Spx/RNA polymerase alpha subunit C-terminal domain complex

PDB Compounds: (A:) Regulatory protein spx

SCOPe Domain Sequences for d3gfka_:

Sequence; same for both SEQRES and ATOM records:

>d3gfka_ c.47.1.12 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkv

Timeline for d3gfka_:

• d3gfka_ is new in SCOPe 2.01-stable
  
• d3gfka_ appears in SCOPe 2.02
  
• d3gfka_ appears in the current release, SCOPe 2.08