SCOPe 2.06: Domain d3ge8c_: 3ge8 C:

Lineage for d3ge8c_ (3ge8 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.0: automated matches [191572] (1 protein)
   not a true family

6. Protein automated matches [190991] (1 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)

8. Domain d3ge8c_: 3ge8 C: [176571]
   Other proteins in same PDB: d3ge8a_, d3ge8d_, d3ge8e_, d3ge8h_
   automated match to d1t0rc_
   complexed with act, fe

Details for d3ge8c_

PDB Entry: 3ge8, 2.19 Å

PDB Description: toluene 4-monooxygenase hd t201a diferric, resting state complex

PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3ge8c_:

Sequence; same for both SEQRES and ATOM records:

>d3ge8c_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

Timeline for d3ge8c_:

• d3ge8c_ first appeared in SCOPe 2.01
  
• d3ge8c_ appears in SCOPe 2.05
  
• d3ge8c_ appears in SCOPe 2.07
  
• d3ge8c_ appears in the current release, SCOPe 2.08