Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Brucella melitensis [TaxId:29459] [188807] (1 PDB entry) |
Domain d3ge4k_: 3ge4 K: [176565] automated match to d1o9ra_ complexed with ca |
PDB Entry: 3ge4 (more details), 1.7 Å
SCOPe Domain Sequences for d3ge4k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ge4k_ a.25.1.1 (K:) automated matches {Brucella melitensis [TaxId: 29459]} smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv rksikdaddagdddtadiftaasrsldkalwfleahvqesn
Timeline for d3ge4k_: