Lineage for d1gsbd1 (1gsb D:85-217)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 98173Species Rat (Rattus norvegicus), class mu [TaxId:10116] [47623] (14 PDB entries)
  8. 98201Domain d1gsbd1: 1gsb D:85-217 [17656]
    Other proteins in same PDB: d1gsba2, d1gsbb2, d1gsbc2, d1gsbd2

Details for d1gsbd1

PDB Entry: 1gsb (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gsbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsbd1 a.45.1.1 (D:85-217) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d1gsbd1:

Click to download the PDB-style file with coordinates for d1gsbd1.
(The format of our PDB-style files is described here.)

Timeline for d1gsbd1: