Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Cladosporium herbarum [TaxId:29918] [189335] (2 PDB entries) |
Domain d3gdga_: 3gdg A: [176529] automated match to d1vl8a_ complexed with na |
PDB Entry: 3gdg (more details), 2.3 Å
SCOPe Domain Sequences for d3gdga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gdga_ c.2.1.0 (A:) automated matches {Cladosporium herbarum [TaxId: 29918]} mpgqqatkheslldqlslkgkvvvvtgasgpkgmgieaargcaemgaavaityasraqga eenvkelektygikakaykcqvdsyesceklvkdvvadfgqidafianagatadsgildg sveawnhvvqvdlngtfhcakavghhfkergtgslvitasmsghianfpqeqtsynvaka gcihmarslanewrdfarvnsispgyidtglsdfvpketqqlwhsmipmgrdglakelkg ayvyfasdastyttgadllidggyttr
Timeline for d3gdga_: