Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein MAP kinase p38 [56129] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56130] (204 PDB entries) |
Domain d3gcub_: 3gcu B: [176523] automated match to d1a9ua_ complexed with bog, mes, r48 |
PDB Entry: 3gcu (more details), 2.1 Å
SCOPe Domain Sequences for d3gcub_:
Sequence, based on SEQRES records: (download)
>d3gcub_ d.144.1.7 (B:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
>d3gcub_ d.144.1.7 (B:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglvatrwyrapeiml nwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesa rnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpd depvadpydqsfesrdllidewksltydevisfvppp
Timeline for d3gcub_: