Lineage for d3gc6a_ (3gc6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117411Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2117455Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2117456Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2117474Species Cow (Bos taurus) [TaxId:9913] [189248] (3 PDB entries)
  8. 2117475Domain d3gc6a_: 3gc6 A: [176511]
    automated match to d2ef1b1
    complexed with so4

Details for d3gc6a_

PDB Entry: 3gc6 (more details), 1.51 Å

PDB Description: structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
PDB Compounds: (A:) Ecto-NAD+ glycohydrolase (CD38 molecule)

SCOPe Domain Sequences for d3gc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gc6a_ c.23.14.3 (A:) ADP ribosyl cyclase {Cow (Bos taurus) [TaxId: 9913]}
ysglnrwhgagstadfqkiiqercdtytqtirpgsrsrncqairqafmsafiskdpckat
kedynslinlapptvpcgqqvfwsktkelaheyakrrrlmtledtllgyladglrwcgep
gssdlniwscpdwrkdcrtnylsvfwevlserfaesacntvrvvlngslenafdsmsifg
rvqapnlrpqveleawlvhdtgkppsdscsgssirklksildgrnvkfrcmdnlsrdqfl
qr

SCOPe Domain Coordinates for d3gc6a_:

Click to download the PDB-style file with coordinates for d3gc6a_.
(The format of our PDB-style files is described here.)

Timeline for d3gc6a_: