Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (5 species) not a true protein |
Species Ctenopharyngodon idella [TaxId:7959] [189272] (1 PDB entry) |
Domain d3gbla_: 3gbl A: [176501] automated match to d1a1mb_ |
PDB Entry: 3gbl (more details), 2.1 Å
SCOPe Domain Sequences for d3gbla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gbla_ b.1.1.0 (A:) automated matches {Ctenopharyngodon idella [TaxId: 7959]} kvsspkiqvyshypgeygkentlicyvsgfhppdisiellkngeviadaqqtdlafekgw qfhltksvsfkpeksdeyscsvrhmsktkkivwesnm
Timeline for d3gbla_: