SCOP 1.59: Domain d6gstb1: 6gst B:85-217

Lineage for d6gstb1 (6gst B:85-217)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Rat (Rattus norvegicus), class mu [TaxId:10116] [47623] (14 PDB entries)

8. Domain d6gstb1: 6gst B:85-217 [17646]
   Other proteins in same PDB: d6gsta2, d6gstb2

Details for d6gstb1

PDB Entry: 6gst, 2.2 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gstb1:

Sequence; same for both SEQRES and ATOM records:

>d6gstb1 a.45.1.1 (B:85-217) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d6gstb1:

• d6gstb1 first appeared (with stable ids) in SCOP 1.55
  
• d6gstb1 appears in SCOP 1.57
  
• d6gstb1 appears in SCOP 1.61
  
• d6gstb1 appears in the current release, SCOPe 2.08