Lineage for d3ga5a_ (3ga5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878508Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 1878537Protein Galactose/glucose-binding protein [53830] (2 species)
  7. 1878548Species Salmonella typhimurium, strain lt2 [TaxId:90371] [53832] (4 PDB entries)
  8. 1878550Domain d3ga5a_: 3ga5 A: [176458]
    automated match to d1gcaa_
    complexed with ca, na, rgg, scn

Details for d3ga5a_

PDB Entry: 3ga5 (more details), 1.87 Å

PDB Description: x-ray structure of glucose/galactose receptor from salmonella typhimurium in complex with (2r)-glyceryl-beta-d-galactopyranoside
PDB Compounds: (A:) D-galactose-binding periplasmic protein

SCOPe Domain Sequences for d3ga5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ga5a_ c.93.1.1 (A:) Galactose/glucose-binding protein {Salmonella typhimurium, strain lt2 [TaxId: 90371]}
trigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgvka
lainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqgdl
iakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldtam
wdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpeal
alvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdkdn
lseft

SCOPe Domain Coordinates for d3ga5a_:

Click to download the PDB-style file with coordinates for d3ga5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ga5a_: