Lineage for d3g9ab_ (3g9a B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931763Species Lama pacos [TaxId:30538] [189142] (2 PDB entries)
  8. 931764Domain d3g9ab_: 3g9a B: [176435]
    Other proteins in same PDB: d3g9aa_
    automated match to d1kxtb_

Details for d3g9ab_

PDB Entry: 3g9a (more details), 1.61 Å

PDB Description: green fluorescent protein bound to minimizer nanobody
PDB Compounds: (B:) Minimizer

SCOPe Domain Sequences for d3g9ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9ab_ b.1.1.1 (B:) automated matches {Lama pacos [TaxId: 30538]}
vqlqesgggsvqaggslrlscaasgdtfssysmawfrqapgkecelvsnilrdgtttyag
svkgrftisrddakntvylqmvnlksedtaryycaadsgtqlgyvgavglscldyvmdyw
gkgtqvtvs

SCOPe Domain Coordinates for d3g9ab_:

Click to download the PDB-style file with coordinates for d3g9ab_.
(The format of our PDB-style files is described here.)

Timeline for d3g9ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3g9aa_