Lineage for d3g8ob_ (3g8o B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1280251Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1281067Protein automated matches [190059] (12 species)
    not a true protein
  7. 1281087Species Human (Homo sapiens) [TaxId:9606] [187214] (121 PDB entries)
  8. 1281121Domain d3g8ob_: 3g8o B: [176424]
    automated match to d1a28a_
    complexed with 30x, so4

Details for d3g8ob_

PDB Entry: 3g8o (more details), 1.9 Å

PDB Description: progesterone receptor with bound pyrrolidine 1
PDB Compounds: (B:) progesterone receptor

SCOPe Domain Sequences for d3g8ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8ob_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

SCOPe Domain Coordinates for d3g8ob_:

Click to download the PDB-style file with coordinates for d3g8ob_.
(The format of our PDB-style files is described here.)

Timeline for d3g8ob_: