SCOP 1.69: Domain d4gsta1: 4gst A:85-217

Lineage for d4gsta1 (4gst A:85-217)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d4gsta1: 4gst A:85-217 [17639]
   Other proteins in same PDB: d4gsta2, d4gstb2

Details for d4gsta1

PDB Entry: 4gst, 1.9 Å

PDB Description: reaction coordinate motion in an snar reaction catalyzed by glutathione transferase

SCOP Domain Sequences for d4gsta1:

Sequence; same for both SEQRES and ATOM records:

>d4gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d4gsta1:

• d4gsta1 first appeared (with stable ids) in SCOP 1.55
  
• d4gsta1 appears in SCOP 1.67
  
• d4gsta1 appears in SCOP 1.71
  
• d4gsta1 appears in the current release, SCOPe 2.08