Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries) |
Domain d3gsta1: 3gst A:85-217 [17637] Other proteins in same PDB: d3gsta2, d3gstb2 complexed with gpr, so4 |
PDB Entry: 3gst (more details), 1.9 Å
SCOPe Domain Sequences for d3gsta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gsta1 a.45.1.1 (A:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]} lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls tpifsklaqwsnk
Timeline for d3gsta1: