Lineage for d6gsua1 (6gsu A:85-217)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153306Species Rat (Rattus norvegicus), class mu [TaxId:10116] [47623] (14 PDB entries)
  8. 153313Domain d6gsua1: 6gsu A:85-217 [17635]
    Other proteins in same PDB: d6gsua2, d6gsub2

Details for d6gsua1

PDB Entry: 6gsu (more details), 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsua1 a.45.1.1 (A:85-217) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d6gsua1:

Click to download the PDB-style file with coordinates for d6gsua1.
(The format of our PDB-style files is described here.)

Timeline for d6gsua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsua2