SCOP 1.55: Domain d6gsua1: 6gsu A:85-217

Lineage for d6gsua1 (6gsu A:85-217)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)

6. Protein Glutathione S-transferase [47618] (22 species)

7. Species Rat (Rattus norvegicus), class mu [TaxId:10116] [47623] (14 PDB entries)

8. Domain d6gsua1: 6gsu A:85-217 [17635]
   Other proteins in same PDB: d6gsua2, d6gsub2

Details for d6gsua1

PDB Entry: 6gsu, 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsua1:

Sequence; same for both SEQRES and ATOM records:

>d6gsua1 a.45.1.1 (A:85-217) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d6gsua1:

• d6gsua1 appears in SCOP 1.57
  
• d6gsua1 appears in the current release, SCOPe 2.08