Lineage for d6gsvb1 (6gsv B:85-217)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48273Species Rat (Rattus norvegicus), class mu [TaxId:10116] [47623] (14 PDB entries)
  8. 48277Domain d6gsvb1: 6gsv B:85-217 [17634]
    Other proteins in same PDB: d6gsva2, d6gsvb2

Details for d6gsvb1

PDB Entry: 6gsv (more details), 1.75 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsvb1 a.45.1.1 (B:85-217) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d6gsvb1:

Click to download the PDB-style file with coordinates for d6gsvb1.
(The format of our PDB-style files is described here.)

Timeline for d6gsvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsvb2