Lineage for d3g48b_ (3g48 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124920Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1124961Protein automated matches [191019] (1 species)
    not a true protein
  7. 1124962Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188801] (1 PDB entry)
  8. 1124964Domain d3g48b_: 3g48 B: [176337]
    automated match to d1gd7a_
    complexed with edo, gol, so4

Details for d3g48b_

PDB Entry: 3g48 (more details), 1.5 Å

PDB Description: crystal structure of chaperone csaa form bacillus anthracis str. ames
PDB Compounds: (B:) Chaperone CsaA

SCOPe Domain Sequences for d3g48b_:

Sequence, based on SEQRES records: (download)

>d3g48b_ b.40.4.4 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amanfedfltldlrigtvthaeefkearvpairleidfgelgmkqssaqitkrynpedli
gqqivavvnfppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis

Sequence, based on observed residues (ATOM records): (download)

>d3g48b_ b.40.4.4 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amanfedfltldlrigtvthaeefpairleidfgelgmkqssaqitkrynpedligqqiv
avvnfppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis

SCOPe Domain Coordinates for d3g48b_:

Click to download the PDB-style file with coordinates for d3g48b_.
(The format of our PDB-style files is described here.)

Timeline for d3g48b_: