SCOPe 2.03: Domain d3g48a_: 3g48 A:

Lineage for d3g48a_ (3g48 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein automated matches [191019] (1 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188801] (1 PDB entry)

8. Domain d3g48a_: 3g48 A: [176336]
   automated match to d1gd7a_
   complexed with edo, gol, so4

Details for d3g48a_

PDB Entry: 3g48, 1.5 Å

PDB Description: crystal structure of chaperone csaa form bacillus anthracis str. ames

PDB Compounds: (A:) Chaperone CsaA

SCOPe Domain Sequences for d3g48a_:

Sequence; same for both SEQRES and ATOM records:

>d3g48a_ b.40.4.4 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amanfedfltldlrigtvthaeefkearvpairleidfgelgmkqssaqitkrynpedli
gqqivavvnfppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis

Timeline for d3g48a_:

• d3g48a_ first appeared in SCOPe 2.01
  
• d3g48a_ appears in SCOPe 2.02
  
• d3g48a_ appears in SCOPe 2.04
  
• d3g48a_ appears in the current release, SCOPe 2.08, called d3g48a1