Lineage for d2gstb1 (2gst B:85-217)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 98173Species Rat (Rattus norvegicus), class mu [TaxId:10116] [47623] (14 PDB entries)
  8. 98175Domain d2gstb1: 2gst B:85-217 [17630]
    Other proteins in same PDB: d2gsta2, d2gstb2

Details for d2gstb1

PDB Entry: 2gst (more details), 1.8 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

SCOP Domain Sequences for d2gstb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gstb1 a.45.1.1 (B:85-217) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d2gstb1:

Click to download the PDB-style file with coordinates for d2gstb1.
(The format of our PDB-style files is described here.)

Timeline for d2gstb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gstb2