Lineage for d1hncb1 (1hnc B:85-217)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153123Species Human (Homo sapiens), class mu [TaxId:9606] [47622] (7 PDB entries)
  8. 153136Domain d1hncb1: 1hnc B:85-217 [17616]
    Other proteins in same PDB: d1hnca2, d1hncb2, d1hncc2, d1hncd2

Details for d1hncb1

PDB Entry: 1hnc (more details), 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hncb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hncb1 a.45.1.1 (B:85-217) Glutathione S-transferase {Human (Homo sapiens), class mu}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

SCOP Domain Coordinates for d1hncb1:

Click to download the PDB-style file with coordinates for d1hncb1.
(The format of our PDB-style files is described here.)

Timeline for d1hncb1: