SCOP 1.59: Domain d1hnca1: 1hnc A:85-217

Lineage for d1hnca1 (1hnc A:85-217)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Human (Homo sapiens), class mu [TaxId:9606] [47622] (7 PDB entries)

8. Domain d1hnca1: 1hnc A:85-217 [17615]
   Other proteins in same PDB: d1hnca2, d1hncb2, d1hncc2, d1hncd2

Details for d1hnca1

PDB Entry: 1hnc, 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hnca1:

Sequence; same for both SEQRES and ATOM records:

>d1hnca1 a.45.1.1 (A:85-217) Glutathione S-transferase {Human (Homo sapiens), class mu}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

Timeline for d1hnca1:

• d1hnca1 first appeared (with stable ids) in SCOP 1.55
  
• d1hnca1 appears in SCOP 1.57
  
• d1hnca1 appears in SCOP 1.61
  
• d1hnca1 appears in the current release, SCOPe 2.08