Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries) |
Domain d3fyic_: 3fyi C: [176140] Other proteins in same PDB: d3fyib1, d3fyib2, d3fyid1, d3fyid2 automated match to d1m56a_ complexed with ca, cd, cu1, cyn, dmu, hea, hto, mg, trd |
PDB Entry: 3fyi (more details), 2.2 Å
SCOPe Domain Sequences for d3fyic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyic_ f.24.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]} wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht
Timeline for d3fyic_: