SCOPe 2.03: Domain d3fyec_: 3fye C:

Lineage for d3fyec_ (3fye C:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries)

8. Domain d3fyec_: 3fye C: [176138]
   Other proteins in same PDB: d3fyeb1, d3fyeb2
   automated match to d1m56a_
   complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx

Details for d3fyec_

PDB Entry: 3fye, 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state

PDB Compounds: (C:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3fyec_:

Sequence; same for both SEQRES and ATOM records:

>d3fyec_ f.24.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

Timeline for d3fyec_:

• d3fyec_ first appeared in SCOPe 2.01
  
• d3fyec_ appears in SCOPe 2.02
  
• d3fyec_ appears in SCOPe 2.04
  
• d3fyec_ appears in the current release, SCOPe 2.08