Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries) |
Domain d3fyea_: 3fye A: [176137] Other proteins in same PDB: d3fyeb1, d3fyeb2, d3fyed1, d3fyed2 automated match to d1m56a_ complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx |
PDB Entry: 3fye (more details), 2.15 Å
SCOPe Domain Sequences for d3fyea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyea_ f.24.1.1 (A:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]} ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
Timeline for d3fyea_: