Lineage for d3fxva1 (3fxv A:248-475)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013024Domain d3fxva1: 3fxv A:248-475 [176130]
    Other proteins in same PDB: d3fxva2
    automated match to d1osha_
    complexed with 643

Details for d3fxva1

PDB Entry: 3fxv (more details), 2.26 Å

PDB Description: identification of an n-oxide pyridine gw4064 analogue as a potent fxr agonist
PDB Compounds: (A:) NR1H4 protein

SCOPe Domain Sequences for d3fxva1:

Sequence, based on SEQRES records: (download)

>d3fxva1 a.123.1.1 (A:248-475) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

Sequence, based on observed residues (ATOM records): (download)

>d3fxva1 a.123.1.1 (A:248-475) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkhsdllearirnsgisdeyitpmfsf
yksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenpq
hfacllgrltelrtfnhhhaemlmswrvhkftpllceiwdv

SCOPe Domain Coordinates for d3fxva1:

Click to download the PDB-style file with coordinates for d3fxva1.
(The format of our PDB-style files is described here.)

Timeline for d3fxva1: